• Keine Ergebnisse gefunden

The epitope peak C (MW unique to 1E3 and 11H3.C10 was found to be GPI amino acid residues 170 to 202 (ALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPE)

N/A
N/A
Protected

Academic year: 2022

Aktie "The epitope peak C (MW unique to 1E3 and 11H3.C10 was found to be GPI amino acid residues 170 to 202 (ALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPE)"

Copied!
2
0
0

Wird geladen.... (Jetzt Volltext ansehen)

Volltext

(1)

Results

45

digested with endoprotease Glu-c and the resulting peptides were incubated with the cross- linked antibodies to bind epitope containing peptides. The non-specific bound peptides were washed away from the beads with a neutral pH buffer while the beads were immobilized on magnet. The bound epitopes containing peptides were eluted with acidic buffer and measured on MALDI-TOF mass spectrometer. The accurate mass of mass of peptide peaks helped to identify the peptide sequence

)LJXUH0DVVVSHFWURPHWULFHSLWRSHPDSSLQJSURILOHRIHSLWRSHH[WUDFWHG*OX&GLJHVWHG*3,

Unique peptide peak masses were identified as epitope containing peptides. Also based on the elution profile patterns it could be once again confirmed that mAbs 11H3.C10, 1E3 recognize the same epitope and that 46H9 recognized a different epitope on GPI. The epitope peak C (MW 3540.2194) unique to 1E3 and 11H3.C10 was found to be GPI amino acid residues 170 to 202 (ALKPYSKGGPRVWFVSNIDGTHIAKTLASLSPE). The epitope peak B (MW 2866.6693) unique to 46H9 was found to be GPI amino acid residues 470 to 495 (GNRPTNSIVFTKLTPFILGALIAMYE).

(2)

Results

46

3URWHLQ WUXQFDWLRQ HSLWRSH PDSSLQJ FRQILUPV WKH PDVV VSHFWURPHWU\ LGHQWLILHG HSLWRSH UHJLRQV

In order to elucidate epitopes of the GPI monoclonal antibodies truncated versions of GST- GPI - i. GPI-I (GPI amino acid residues 1-190); ii. GPI-II (GPI amino acid residues 1-368);

iii. GPI-III (GPI amino acid residues 324-559); IV. GPI-IV (GPI amino acid residues 485- 559) were generated. The expressed proteins were used in western blot analysis with the GPI mAbs. It could be shown that 11H3.C10 and IE3 reacted to GST-GPI (1-368) only and do not react with GST-GPI(1-190) meaning that these antibodies have epitopes lying within GPI amino acid residues 170-324. The 46H9 antibody reacted only to GST-GPI(324-559) and showed no reactivity to GST-GPI(485-559) showing that its epitopes lies between GPI residues 324-485. Also to be noted is that the epitope residues identified by mass spectrometric epitope mapping for 1E3/11H3.C10 (170-202) and for 46H9 (470-495) are also exclusively present only in the truncated GPI clones reacting with antibodies on western blots.

)LJXUH:HVWHUQEORWVKRZLQJWKHUHDFWLYLWLHVRIP*3,P$EWRH[SUHVVHGWUXQFDWHGSURWHLQVRIPRXVH*3, The lanes were loaded with bacterial lysates expressing(A) GST. (B) GST-mGPI(1-190). (C) GST-mGPI(1-368).

(D) GST-mGPI(324-559). (E) GST-mGPI(489-559).

Referenzen

ÄHNLICHE DOKUMENTE

The present work describes the determination of the epitope of hCC to a monoclonal antibody raised against cystatin C, Cyst-B, by MALOI mass spectrometry, using proteolytic

This could be confirmed with Glu-c digested GPI peptide blot (figure 22). Thus it could be concluded that 1E3 and 11H3.C10 GPI mAb recognized the same epitope on GPI, while 46H9 had

For example in diphenylalanine in solution, a conformational transition is observed upon aggregation: in bulk water the molecule adopts a trans-like state, but the molecular

The maximum molecular brightness method was rst applied to investigate lipid diusion in Black Lipid Membranes (BLMs), in particular the inuence of mono- and divalent ions on neutral

[5] (B) The IHF mimicking model peptide consisting of a minor grove binding cyclic unit, a positively charged lysine dendrimer and a glycine linker including

In contrast, in the liquid-crystalline state the average (or projected) chain length is distinctly reduced due to the flexing motions produced by trans-gauche

(Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press), pp. Cold Spring Harbor Laboratory Press, New York. Interacting genes in nematode dauer larva formation. elegans

Additionally, the intramolecular energy transfer efficiency have been measured with the Trp/DBO pair and the effective average end-to-end distances were calculated, which provided